(data stored in ACNUC7421 zone)

EMBL: CP001700.PE283

CP001700.PE283       Location/Qualifiers
FT   CDS             323059..323949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro02601 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69238"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ96"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro02601"
FT                   /protein_id="ACU69238.1"
FT                   /translation="MSHSTFNTPAAIAVALDLYVADVRIVAADRADTVVEVRPSDPNKA
FT                   ADVKAAENTRVEYDEGARVLSIVSRKPRNRFVNFSSKRPESIDLLIEVPTDSDVRGETE
FT                   IGDFESVGVLGAVQLKAGVGTVRLAQVGPVNIRDGVGEVLIEEVSGAADVNCGSGVIRL
FT                   GAVDGTAEVSNGNGKVRVGVVTGAANVKSANGEVSVDRALSDITASASNGEVRVGEVVR
FT                   GKATVTSKNGAVEVGVREGSAAWLELSTAVGRVYNELESADAPQAGEPVDKVEIHASTK
FT                   LGDVTIRRVPRLDED"
     MSHSTFNTPA AIAVALDLYV ADVRIVAADR ADTVVEVRPS DPNKAADVKA AENTRVEYDE        60
     GARVLSIVSR KPRNRFVNFS SKRPESIDLL IEVPTDSDVR GETEIGDFES VGVLGAVQLK       120
     AGVGTVRLAQ VGPVNIRDGV GEVLIEEVSG AADVNCGSGV IRLGAVDGTA EVSNGNGKVR       180
     VGVVTGAANV KSANGEVSVD RALSDITASA SNGEVRVGEV VRGKATVTSK NGAVEVGVRE       240
     GSAAWLELST AVGRVYNELE SADAPQAGEP VDKVEIHAST KLGDVTIRRV PRLDED           296
//

If you have problems or comments...

PBIL Back to PBIL home page