(data stored in ACNUC7421 zone)

EMBL: CP001700.PE284

CP001700.PE284       Location/Qualifiers
FT   CDS             323955..324878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0286"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: sco:SCO4405 ABC transport system ATP-binding
FT                   protein; TIGRFAM: daunorubicin resistance ABC transporter
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69239"
FT                   /db_xref="GOA:C7QJ97"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ97"
FT                   /inference="protein motif:TFAM:TIGR01188"
FT                   /protein_id="ACU69239.1"
FT                   /translation="MIAISARGLRKSFGEKTVLDGIDLSVPAGTILALLGPNGAGKTTA
FT                   VHLLTTYLRPDAGEIVIAGHDLAKSPQAVRRVIGVTGQFSAVDGYLTGRENLMLMADLH
FT                   LLPKAVGRQRADDLLERFELTEAAGKAAATCSGGMKRKLDLAMTLVGDPKVIFLDEPTT
FT                   GLDPRSRRVMWDIIRGLVAEGTTILLTTQYLDEADQLAHRVAVLDGGRIVAEGTPAELK
FT                   TRIPGGHIELTFADRAELDAAALVLAPTHRDDDALTLQLAGDGRVSALRSLLQRLDDAS
FT                   VEVEALAVHTPDLDDVFFALTGKKGA"
     MIAISARGLR KSFGEKTVLD GIDLSVPAGT ILALLGPNGA GKTTAVHLLT TYLRPDAGEI        60
     VIAGHDLAKS PQAVRRVIGV TGQFSAVDGY LTGRENLMLM ADLHLLPKAV GRQRADDLLE       120
     RFELTEAAGK AAATCSGGMK RKLDLAMTLV GDPKVIFLDE PTTGLDPRSR RVMWDIIRGL       180
     VAEGTTILLT TQYLDEADQL AHRVAVLDGG RIVAEGTPAE LKTRIPGGHI ELTFADRAEL       240
     DAAALVLAPT HRDDDALTLQ LAGDGRVSAL RSLLQRLDDA SVEVEALAVH TPDLDDVFFA       300
     LTGKKGA                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page