(data stored in ACNUC7421 zone)

EMBL: CP001700.PE285

CP001700.PE285       Location/Qualifiers
FT   CDS             324880..325734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0287"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: rha:RHA1_ro02603
FT                   multidrug ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69240"
FT                   /db_xref="GOA:C7QJ98"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ98"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACU69240.1"
FT                   /translation="MSAMTVADSGLADTGADTRSHAWVHARIMLRRNLRHLQRYPSLTL
FT                   MVTLMPLVFLLLFVYVFGGTLGSGLGSLTPAGVHGGRAAYAAYVAPAIIVMAVAAAAQG
FT                   TAIAVAQDMTEGIIARFRTMAVARSSVLTGHVVGAAIQTMAGVAVVVGAALAVGFRPHA
FT                   NAAEWFAALGVVLLLTFAVTWLCVGLGLSAKSVETASNSPMFLLLLPFLSSGFVPTDSL
FT                   PTGMRWFSEYEPFTPVTETLRGLLTGTRIGGDLVVTLAWCLGVAVLSYAWSRRLYEREP
FT                   KQS"
     MSAMTVADSG LADTGADTRS HAWVHARIML RRNLRHLQRY PSLTLMVTLM PLVFLLLFVY        60
     VFGGTLGSGL GSLTPAGVHG GRAAYAAYVA PAIIVMAVAA AAQGTAIAVA QDMTEGIIAR       120
     FRTMAVARSS VLTGHVVGAA IQTMAGVAVV VGAALAVGFR PHANAAEWFA ALGVVLLLTF       180
     AVTWLCVGLG LSAKSVETAS NSPMFLLLLP FLSSGFVPTD SLPTGMRWFS EYEPFTPVTE       240
     TLRGLLTGTR IGGDLVVTLA WCLGVAVLSY AWSRRLYERE PKQS                        284
//

If you have problems or comments...

PBIL Back to PBIL home page