(data stored in ACNUC7421 zone)

EMBL: CP001700.PE286

CP001700.PE286       Location/Qualifiers
FT   CDS             325731..326642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0288"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="KEGG: fra:Francci3_4373
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   TIGRFAM: phosphoribosylaminoimidazole- succinocarboxamide
FT                   synthase; PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69241"
FT                   /db_xref="GOA:C7QJ99"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ99"
FT                   /inference="protein motif:TFAM:TIGR00081"
FT                   /protein_id="ACU69241.1"
FT                   /translation="MNRRYSERVITGLNHLASGKIRDLYAVGDDLLLVASDKISAFDYV
FT                   LESEIPDKGRILTQLSMWWFRQLADLVPNHVISADVEQFPAELQPYKEELRGRSMLCRK
FT                   LSMVQVECVARGYLTGSGLAEYERTRTANGVPLPPGLVDGSRLDRPIFTPAMKAEVGQH
FT                   DENVSFEDMAERIGDPELAAQLKDLTLAVYSRAREIAEERGIILADTKFEFGRLRGGTL
FT                   VLADEVLTPDSSRFWPADEWKPGRTQSSFDKQYVRDWLSSPASGWDRKSDTPPPVLPEE
FT                   VVQATRARYVEAYERLTGAKFD"
     MNRRYSERVI TGLNHLASGK IRDLYAVGDD LLLVASDKIS AFDYVLESEI PDKGRILTQL        60
     SMWWFRQLAD LVPNHVISAD VEQFPAELQP YKEELRGRSM LCRKLSMVQV ECVARGYLTG       120
     SGLAEYERTR TANGVPLPPG LVDGSRLDRP IFTPAMKAEV GQHDENVSFE DMAERIGDPE       180
     LAAQLKDLTL AVYSRAREIA EERGIILADT KFEFGRLRGG TLVLADEVLT PDSSRFWPAD       240
     EWKPGRTQSS FDKQYVRDWL SSPASGWDRK SDTPPPVLPE EVVQATRARY VEAYERLTGA       300
     KFD                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page