(data stored in ACNUC7421 zone)

EMBL: CP001700.PE287

CP001700.PE287       Location/Qualifiers
FT   CDS             326749..327015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0289"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase,
FT                   purS; PFAM: phosphoribosylformylglycinamidine synthetase
FT                   PurS; KEGG: sco:SCO4077 phosphoribosylformylglycinamidine
FT                   synthase subunit PurS"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69242"
FT                   /db_xref="GOA:C7QJA0"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA0"
FT                   /inference="protein motif:TFAM:TIGR00302"
FT                   /protein_id="ACU69242.1"
FT                   /translation="MARVLVDVMLKPEILDPQGQAVQRALPRMGFDSVTNVRQGKRFEL
FT                   ELADADPATLRATAEQMAEKLLANTVIEDFKVTVLPADSSENA"
     MARVLVDVML KPEILDPQGQ AVQRALPRMG FDSVTNVRQG KRFELELADA DPATLRATAE        60
     QMAEKLLANT VIEDFKVTVL PADSSENA                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page