(data stored in ACNUC7421 zone)

EMBL: CP001700.PE288

CP001700.PE288       Location/Qualifiers
FT   CDS             327015..327701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0290"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: sma:SAV_4139 phosphoribosylformylglycinamidine
FT                   synthase subunit I; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase I; PFAM:
FT                   CobB/CobQ domain protein glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69243"
FT                   /db_xref="GOA:C7QJA1"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA1"
FT                   /inference="protein motif:TFAM:TIGR01737"
FT                   /protein_id="ACU69243.1"
FT                   /translation="MPARIGVVTFPGTLDDRQALRAAAAVGAEPVALWHKDRDLHQVDA
FT                   VVLPGGFSYGDYLRAGAIARFSPVMDTIIDAARDGLPVLGICNGFQVLCETHLLEGAMI
FT                   RNGDLHFINRDVTLRIENNRTAWTSDYEDGAEAVIPIKNVDGRFVADEPTLDALEAEGR
FT                   VLARYVANPNGAARDIAGITNAAGNVVGLMPHPEYAIDDLTGPHPGPGTDGLPFFTSIL
FT                   KSLVSA"
     MPARIGVVTF PGTLDDRQAL RAAAAVGAEP VALWHKDRDL HQVDAVVLPG GFSYGDYLRA        60
     GAIARFSPVM DTIIDAARDG LPVLGICNGF QVLCETHLLE GAMIRNGDLH FINRDVTLRI       120
     ENNRTAWTSD YEDGAEAVIP IKNVDGRFVA DEPTLDALEA EGRVLARYVA NPNGAARDIA       180
     GITNAAGNVV GLMPHPEYAI DDLTGPHPGP GTDGLPFFTS ILKSLVSA                    228
//

If you have problems or comments...

PBIL Back to PBIL home page