(data stored in ACNUC7421 zone)

EMBL: CP001700.PE289

CP001700.PE289       Location/Qualifiers
FT   CDS             327698..330061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0291"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: sgr:SGR_3871 putative phosphoribosyl
FT                   formylglycinamidine synthase II; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase II; PFAM: AIR
FT                   synthase related protein domain protein; AIR synthase
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69244"
FT                   /db_xref="GOA:C7QJA2"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA2"
FT                   /inference="protein motif:TFAM:TIGR01736"
FT                   /protein_id="ACU69244.1"
FT                   /translation="MSNGNSSENVFDTTDVFVDTAVSFDTVAKAAQTPDVKQPFRELGM
FT                   TEDEYLRVREILGRRPSSSELAMYSVMWSEHCSYKSSRVHLKQFGEKAPKTAALLVGPG
FT                   ENAGVVDVGEGLAVTFKVESHNHPSYVEPYQGAATGVGGIVRDILTMGARPIAVMDPLR
FT                   FGPADAPDTARVLPGVVAGVGGYGNCLGVPNIGGEIVFDPCYLGNPLVNALCVGVMRAD
FT                   EIKLAKAPGPGNQVILFGARTGGDGIGGASVLASATFDEDGPAKRPSVQVGDPFMEKVL
FT                   IECCLEIFAADLVVGIQDLGAAGLTCSTTELAAAGTGGMDVRLDLAPLRDSTLTPEEVL
FT                   MSESQERMMAVVEPAKVEAFLAVCDKWDVTATALGEVTDTGRLRMWWHGEIIVDVPPRT
FT                   LAHEGPVYNRPFARPEWQDALQADAPTAERLKRPGNAEELRETLLRLVGSPNLADKTWA
FT                   VEQYDHRVQGNTVLGHGEDSGMVRLDAALPGTSLGVALSTDGNGRFAKLDPYQGAQLAL
FT                   AEAYRNVAATGAKPLAVTDCLNFGSPEDPDVMWQFAEACRGLADACLELGTPVTGGNVS
FT                   FYNQTGELNIHPTPVVGVLGVIDDVDRRTRSAFEREGEILLLLGDTRDEFGGSEWAHEV
FT                   HGHLGGLPPRLDLQREKVLGEVLIAGSRDGMLSAAHDLSDGGLAQAVVEGCLRGGHGAR
FT                   LVLPETDADGAALDPFVALFAESAGRALVAVPRSEELRFTDMCVARGLPVARVGVVDGD
FT                   VLEVQGQFTVPMAELRTAHEAPFRKLFGHSVVDA"
     MSNGNSSENV FDTTDVFVDT AVSFDTVAKA AQTPDVKQPF RELGMTEDEY LRVREILGRR        60
     PSSSELAMYS VMWSEHCSYK SSRVHLKQFG EKAPKTAALL VGPGENAGVV DVGEGLAVTF       120
     KVESHNHPSY VEPYQGAATG VGGIVRDILT MGARPIAVMD PLRFGPADAP DTARVLPGVV       180
     AGVGGYGNCL GVPNIGGEIV FDPCYLGNPL VNALCVGVMR ADEIKLAKAP GPGNQVILFG       240
     ARTGGDGIGG ASVLASATFD EDGPAKRPSV QVGDPFMEKV LIECCLEIFA ADLVVGIQDL       300
     GAAGLTCSTT ELAAAGTGGM DVRLDLAPLR DSTLTPEEVL MSESQERMMA VVEPAKVEAF       360
     LAVCDKWDVT ATALGEVTDT GRLRMWWHGE IIVDVPPRTL AHEGPVYNRP FARPEWQDAL       420
     QADAPTAERL KRPGNAEELR ETLLRLVGSP NLADKTWAVE QYDHRVQGNT VLGHGEDSGM       480
     VRLDAALPGT SLGVALSTDG NGRFAKLDPY QGAQLALAEA YRNVAATGAK PLAVTDCLNF       540
     GSPEDPDVMW QFAEACRGLA DACLELGTPV TGGNVSFYNQ TGELNIHPTP VVGVLGVIDD       600
     VDRRTRSAFE REGEILLLLG DTRDEFGGSE WAHEVHGHLG GLPPRLDLQR EKVLGEVLIA       660
     GSRDGMLSAA HDLSDGGLAQ AVVEGCLRGG HGARLVLPET DADGAALDPF VALFAESAGR       720
     ALVAVPRSEE LRFTDMCVAR GLPVARVGVV DGDVLEVQGQ FTVPMAELRT AHEAPFRKLF       780
     GHSVVDA                                                                 787
//

If you have problems or comments...

PBIL Back to PBIL home page