(data stored in ACNUC7421 zone)

EMBL: CP001700.PE29

CP001700.PE29        Location/Qualifiers
FT   CDS             complement(29325..29969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0029"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   mjl:Mjls_3025 lysine exporter protein LysE/YggA"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68984"
FT                   /db_xref="GOA:C7QFP5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP5"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACU68984.1"
FT                   /translation="MLATLLPFLIACTAVAAVPGQSTALIIRQSIRGGKRAGFATVLGN
FT                   ESGVFVWGCAAAFGFTALLAASEIAYDGMRVVGACVLVWFAVQSFRSARRMKQDEAAEE
FT                   TDELGGDARTKGPLWSYRAGLLTNLANPKAAIFAMSFLPQFVPAHAPKLPTMVLLAATW
FT                   AVYEVFYYSLYVWCVQRLRAFFSRREVRRRMEQISGTVMLGLAVRMVVENS"
     MLATLLPFLI ACTAVAAVPG QSTALIIRQS IRGGKRAGFA TVLGNESGVF VWGCAAAFGF        60
     TALLAASEIA YDGMRVVGAC VLVWFAVQSF RSARRMKQDE AAEETDELGG DARTKGPLWS       120
     YRAGLLTNLA NPKAAIFAMS FLPQFVPAHA PKLPTMVLLA ATWAVYEVFY YSLYVWCVQR       180
     LRAFFSRREV RRRMEQISGT VMLGLAVRMV VENS                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page