(data stored in ACNUC7421 zone)

EMBL: CP001700.PE290

CP001700.PE290       Location/Qualifiers
FT   CDS             complement(330071..330865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lic:LIC12006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69245"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69245.1"
FT                   /translation="MAWFVHLTPEKNSARVRRSGLSPISRSRSDDPRPGLYCTPLLADY
FT                   TLTYQWSREIKRWKSPRLAAVHFRIPDDTAVTVGYYGDAPKPVTAAQAVARFLSLSPEE
FT                   MRGYEVFLPRGVTAKEIRRIKSLERPIGWRYRPNAHGHRPCACPACLDRGEYRISRIRD
FT                   KSSYYDTSHLPPRQEVLEKLATTRDSAEIVTLLDQLRSRGQGDIFRVAHLADHPDPDVR
FT                   EALAYALCGFNKKAAAELLEKLRSDPLKDVREAAGADEDDDL"
     MAWFVHLTPE KNSARVRRSG LSPISRSRSD DPRPGLYCTP LLADYTLTYQ WSREIKRWKS        60
     PRLAAVHFRI PDDTAVTVGY YGDAPKPVTA AQAVARFLSL SPEEMRGYEV FLPRGVTAKE       120
     IRRIKSLERP IGWRYRPNAH GHRPCACPAC LDRGEYRISR IRDKSSYYDT SHLPPRQEVL       180
     EKLATTRDSA EIVTLLDQLR SRGQGDIFRV AHLADHPDPD VREALAYALC GFNKKAAAEL       240
     LEKLRSDPLK DVREAAGADE DDDL                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page