(data stored in ACNUC7421 zone)

EMBL: CP001700.PE291

CP001700.PE291       Location/Qualifiers
FT   CDS             complement(330896..331846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0293"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO2835 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69246"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69246.1"
FT                   /translation="MNTETTATGASFYALGPEFEWMASAWDGFAHELAEVSKTLRQIVE
FT                   AATADPQLAAESSGLAALESATDRLVRELVDDAARIRRTQATYEHADATVHASVPPLHA
FT                   HEQPPPGHAPEVSTIPVFGAGVVTGHQNTPGSAPGSDTAGSYAGTLDGPASAPASVPVP
FT                   DGSGLWHPAVAQDLSETALGTLSRMRRQMIAHADRWVSQHVPYNQGIWHEGYRTDCSGY
FT                   VSMCWGLRDSMVTSTMPQISHRIAKEDLRPGDVLLNTDVATGHVILFDRWADYAHNSYV
FT                   GYELCPQGTLHHVIPYPYYSGFGVYEPYRYNNAGD"
     MNTETTATGA SFYALGPEFE WMASAWDGFA HELAEVSKTL RQIVEAATAD PQLAAESSGL        60
     AALESATDRL VRELVDDAAR IRRTQATYEH ADATVHASVP PLHAHEQPPP GHAPEVSTIP       120
     VFGAGVVTGH QNTPGSAPGS DTAGSYAGTL DGPASAPASV PVPDGSGLWH PAVAQDLSET       180
     ALGTLSRMRR QMIAHADRWV SQHVPYNQGI WHEGYRTDCS GYVSMCWGLR DSMVTSTMPQ       240
     ISHRIAKEDL RPGDVLLNTD VATGHVILFD RWADYAHNSY VGYELCPQGT LHHVIPYPYY       300
     SGFGVYEPYR YNNAGD                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page