(data stored in ACNUC7421 zone)

EMBL: CP001700.PE292

CP001700.PE292       Location/Qualifiers
FT   CDS             complement(331843..332277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0294"
FT                   /product="chromosome segregation protein SMC"
FT                   /note="KEGG: met:M446_6942 chromosome segregation protein
FT                   SMC"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69247"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA5"
FT                   /inference="similar to AA sequence:KEGG:M446_6942"
FT                   /protein_id="ACU69247.1"
FT                   /translation="MITAQTPASAPTDDAGRTPERAAMAGAIDAQARRMDQLSAAIVRA
FT                   TSQVTWSGRAAERFRARAAERSRECLQLAVALRASAERVHAAETARPAATHAGQAPADE
FT                   KSGHAAVVGAISGMAGTKIPGVAGGGVGGARPSSESGPAR"
     MITAQTPASA PTDDAGRTPE RAAMAGAIDA QARRMDQLSA AIVRATSQVT WSGRAAERFR        60
     ARAAERSREC LQLAVALRAS AERVHAAETA RPAATHAGQA PADEKSGHAA VVGAISGMAG       120
     TKIPGVAGGG VGGARPSSES GPAR                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page