(data stored in ACNUC7421 zone)

EMBL: CP001700.PE293

CP001700.PE293       Location/Qualifiers
FT   CDS             332467..333234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_4137 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69248"
FT                   /db_xref="GOA:C7QJA6"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR041629"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA6"
FT                   /inference="similar to AA sequence:KEGG:SAV_4137"
FT                   /protein_id="ACU69248.1"
FT                   /translation="MPKTRRPASAKVRQAVVNQWQAHVGYAAALTAEQLAAPSKLAGWD
FT                   VKTLVGHVAFTVRTVVTRAAEPVAGDQAEVYDWLTATPTASAAVDAGTRELVEDGVVLA
FT                   DEVTEAEKLMERYGDEDLIAMRFGPMRFDDFLVSRIVEATVHADDLERSTGIEFPHDRE
FT                   ALAITVRQLADAMAAKVPGNSVELRVPPFAAVQCVPGPRHTRGTPPNVVEMTPRTWIRL
FT                   AAGRMTWDEAMDQALVSASGQRADLKEFLPLMG"
     MPKTRRPASA KVRQAVVNQW QAHVGYAAAL TAEQLAAPSK LAGWDVKTLV GHVAFTVRTV        60
     VTRAAEPVAG DQAEVYDWLT ATPTASAAVD AGTRELVEDG VVLADEVTEA EKLMERYGDE       120
     DLIAMRFGPM RFDDFLVSRI VEATVHADDL ERSTGIEFPH DREALAITVR QLADAMAAKV       180
     PGNSVELRVP PFAAVQCVPG PRHTRGTPPN VVEMTPRTWI RLAAGRMTWD EAMDQALVSA       240
     SGQRADLKEF LPLMG                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page