(data stored in ACNUC7421 zone)

EMBL: CP001700.PE294

CP001700.PE294       Location/Qualifiers
FT   CDS             333393..334910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0296"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="TIGRFAM: amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase class-II;
FT                   phosphoribosyltransferase; KEGG: nca:Noca_4316
FT                   amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69249"
FT                   /db_xref="GOA:C7QJA7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA7"
FT                   /inference="protein motif:TFAM:TIGR01134"
FT                   /protein_id="ACU69249.1"
FT                   /translation="MIHPSGFRPGDGRLTHELDPQDTGPQDACGVFGVWAPGEEVAKLA
FT                   YFGLYALQHRGQESAGIAVSNGKQILVYKDMGLVSQVFDEATLQSLQGYLAIGHARYST
FT                   TGSSVWENAQPTFRATAHGAVALGHNGNLTNTGELARLAAERRTTSGAGDKHAMTSDTG
FT                   LMTELLASYSDRSLEDAAAEVLPQLRGAFSLVFMDETTLYAARDPQGVRPLMLGRLDRG
FT                   WVVASEQAALDTVGASFIREIEPGELIAVDENGLRSRHFAEPQPKGCVFEYVYLARPDA
FT                   TISGRNVHAARVEMGRTLAREAPVEADLVIATPESGTPAAIGFAEESGIPFGQGFVKNA
FT                   YVGRTFIQPSQTLRQLGVRLKLNALREVIEGKRLVVVDDSIVRGNTQRAVSKMLREAGA
FT                   TEVHLRISSPPVKWPCFYGIDFATRAELIANGLNTDEIAKSIGADSLAYITLDGMTAAT
FT                   HQPADRLCRACFDGVYPIALPEDELLGKHLLEISVDPLAHTDALSRP"
     MIHPSGFRPG DGRLTHELDP QDTGPQDACG VFGVWAPGEE VAKLAYFGLY ALQHRGQESA        60
     GIAVSNGKQI LVYKDMGLVS QVFDEATLQS LQGYLAIGHA RYSTTGSSVW ENAQPTFRAT       120
     AHGAVALGHN GNLTNTGELA RLAAERRTTS GAGDKHAMTS DTGLMTELLA SYSDRSLEDA       180
     AAEVLPQLRG AFSLVFMDET TLYAARDPQG VRPLMLGRLD RGWVVASEQA ALDTVGASFI       240
     REIEPGELIA VDENGLRSRH FAEPQPKGCV FEYVYLARPD ATISGRNVHA ARVEMGRTLA       300
     REAPVEADLV IATPESGTPA AIGFAEESGI PFGQGFVKNA YVGRTFIQPS QTLRQLGVRL       360
     KLNALREVIE GKRLVVVDDS IVRGNTQRAV SKMLREAGAT EVHLRISSPP VKWPCFYGID       420
     FATRAELIAN GLNTDEIAKS IGADSLAYIT LDGMTAATHQ PADRLCRACF DGVYPIALPE       480
     DELLGKHLLE ISVDPLAHTD ALSRP                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page