(data stored in ACNUC7421 zone)

EMBL: CP001700.PE295

CP001700.PE295       Location/Qualifiers
FT   CDS             334959..336044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0297"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="KEGG: sgr:SGR_3878 putative
FT                   phosphoribosylaminoimidazole synthetase; TIGRFAM:
FT                   phosphoribosylformylglycinamidine cyclo- ligase; PFAM: AIR
FT                   synthase related protein domain protein; AIR synthase
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69250"
FT                   /db_xref="GOA:C7QJA8"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA8"
FT                   /inference="protein motif:TFAM:TIGR00878"
FT                   /protein_id="ACU69250.1"
FT                   /translation="MSGATYAAAGVDIEAGDRAVELMKEWVAKTRRPEVLGGIGGFAGL
FT                   FDASALKAYDRPLLATSTDGVGTKVAIAQRMDRHDTIGRDLVGMVVDDLVVCGAEPLFM
FT                   TDYIATGKVVPEVIAGIVKGIAEGCVLAGCALVGGETAEHPGLLKPGEYDVAGAGTGVV
FT                   EADKVLGAERVREGDVLVAMASSGAHSNGYSLLRHVFFDVAGWELDRDVPEFGRTLGEE
FT                   LLEPTRIYSLDCLALIEAAEVHAISHITGGGVAANIARIIPAGLEARLDRGTWTPPAVF
FT                   GTVGALGGVATLELEKTLNMGVGMVAVLPAASVDPALALLNARGLPSWVCGEVVASEGA
FT                   VTVGGAKGGDGAASLHGDYAG"
     MSGATYAAAG VDIEAGDRAV ELMKEWVAKT RRPEVLGGIG GFAGLFDASA LKAYDRPLLA        60
     TSTDGVGTKV AIAQRMDRHD TIGRDLVGMV VDDLVVCGAE PLFMTDYIAT GKVVPEVIAG       120
     IVKGIAEGCV LAGCALVGGE TAEHPGLLKP GEYDVAGAGT GVVEADKVLG AERVREGDVL       180
     VAMASSGAHS NGYSLLRHVF FDVAGWELDR DVPEFGRTLG EELLEPTRIY SLDCLALIEA       240
     AEVHAISHIT GGGVAANIAR IIPAGLEARL DRGTWTPPAV FGTVGALGGV ATLELEKTLN       300
     MGVGMVAVLP AASVDPALAL LNARGLPSWV CGEVVASEGA VTVGGAKGGD GAASLHGDYA       360
     G                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page