(data stored in ACNUC7421 zone)

EMBL: CP001700.PE296

CP001700.PE296       Location/Qualifiers
FT   CDS             complement(336315..336587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO4088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69251"
FT                   /db_xref="InterPro:IPR021426"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJA9"
FT                   /inference="similar to AA sequence:KEGG:SCO4088"
FT                   /protein_id="ACU69251.1"
FT                   /translation="MGRGRAKAKQTRVARDLKYRDVRTDLTQLQRELQQDGVHTSNGHS
FT                   AEAPSQQDDDADDDELYAKYADDDGDDDYDSADDGGAHRSHHRRS"
     MGRGRAKAKQ TRVARDLKYR DVRTDLTQLQ RELQQDGVHT SNGHSAEAPS QQDDDADDDE        60
     LYAKYADDDG DDDYDSADDG GAHRSHHRRS                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page