(data stored in ACNUC7421 zone)

EMBL: CP001700.PE297

CP001700.PE297       Location/Qualifiers
FT   CDS             complement(336830..337918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0299"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase dimerisation
FT                   region"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase dimerisation
FT                   region; Glu/Leu/Phe/Val dehydrogenase; KEGG: saq:Sare_0168
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69252"
FT                   /db_xref="GOA:C7QJB0"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR016211"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB0"
FT                   /inference="protein motif:PFAM:PF02812"
FT                   /protein_id="ACU69252.1"
FT                   /translation="MSDKPDNDVSEVFASDHEQVVYCRDEETGLKAIIAVHNTLLGPGL
FT                   GGTRFFPYATEQDALKDVLRLSRGMSYKNALAGLDLGGGKAVIIGDPSEIKTEALLRAY
FT                   GRFVQSLNGRYYTACDVGTYVQDMDVVAKESRFVTGRSMESGGAGDSSVLTAYGVFQGM
FT                   RASAEYLWGSPSLAGKRVGISGVGKVGRYLIGHLIEDGASIVATDPYEGAIQWLRDNYA
FT                   QVELVSTTEDLIAADIDVYAPCALGGALDDATVAALTAKIVCGAANNQLAHTGVEKQLE
FT                   ARGILYAPDYLVNSGGVIQVADEIHGFDFERAKRRASGIFDTTMRIYSLASEEGVPPSV
FT                   AADRLAERRMRDVGRLRGVYLP"
     MSDKPDNDVS EVFASDHEQV VYCRDEETGL KAIIAVHNTL LGPGLGGTRF FPYATEQDAL        60
     KDVLRLSRGM SYKNALAGLD LGGGKAVIIG DPSEIKTEAL LRAYGRFVQS LNGRYYTACD       120
     VGTYVQDMDV VAKESRFVTG RSMESGGAGD SSVLTAYGVF QGMRASAEYL WGSPSLAGKR       180
     VGISGVGKVG RYLIGHLIED GASIVATDPY EGAIQWLRDN YAQVELVSTT EDLIAADIDV       240
     YAPCALGGAL DDATVAALTA KIVCGAANNQ LAHTGVEKQL EARGILYAPD YLVNSGGVIQ       300
     VADEIHGFDF ERAKRRASGI FDTTMRIYSL ASEEGVPPSV AADRLAERRM RDVGRLRGVY       360
     LP                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page