(data stored in ACNUC7421 zone)

EMBL: CP001700.PE298

CP001700.PE298       Location/Qualifiers
FT   CDS             338165..339100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO4090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69253"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB1"
FT                   /inference="similar to AA sequence:KEGG:SCO4090"
FT                   /protein_id="ACU69253.1"
FT                   /translation="MRASPGGAIPAPYMAYLRVYEPLAAFPAGERAEWEAWLLRNPEPK
FT                   SLAEEQSASLRGLVAVPPIAVPENESRVAYVLDNGETTLLCPWQSRLRSWLALTELRAV
FT                   HGDGGVRLFWPRGVLERADSEYERWWAEDPEALPHILTASWQVPIRWLVLFGLEDAVTD
FT                   ADGPGDRSDRGDRGEAGEGDEKVAAVTLQFRTAMSQARKRCARALRVLKRSLGAGPLVE
FT                   AVETLGMWLEEFHPHSVVELDYGGLMGLLVAQGALGAEERVDGIVLDCSVRYVADGLAA
FT                   LAQGDDTGVTAAYLRYRAKWDAVRVLARAN"
     MRASPGGAIP APYMAYLRVY EPLAAFPAGE RAEWEAWLLR NPEPKSLAEE QSASLRGLVA        60
     VPPIAVPENE SRVAYVLDNG ETTLLCPWQS RLRSWLALTE LRAVHGDGGV RLFWPRGVLE       120
     RADSEYERWW AEDPEALPHI LTASWQVPIR WLVLFGLEDA VTDADGPGDR SDRGDRGEAG       180
     EGDEKVAAVT LQFRTAMSQA RKRCARALRV LKRSLGAGPL VEAVETLGMW LEEFHPHSVV       240
     ELDYGGLMGL LVAQGALGAE ERVDGIVLDC SVRYVADGLA ALAQGDDTGV TAAYLRYRAK       300
     WDAVRVLARA N                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page