(data stored in ACNUC7421 zone)

EMBL: CP001700.PE3

CP001700.PE3         Location/Qualifiers
FT   CDS             4110..4988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0003"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   NAD-binding; 6-phosphogluconate dehydrogenase domain
FT                   protein; KEGG: sco:SCO3877 6-phosphogluconate
FT                   dehydrogenase- like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68958"
FT                   /db_xref="GOA:C7QFL9"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFL9"
FT                   /inference="protein motif:TFAM:TIGR00872"
FT                   /protein_id="ACU68958.1"
FT                   /translation="MEIGLVGLGKMGGNMRERIRQAGHTVVGYDRDPKLADVGSLKELV
FT                   QTLAAPRVIWIMVPAGEATDATVNELADLLHTGDMVIDGGNSRWTEDIKHAELLKAQGV
FT                   AFVDAGVSGGVWGLQNGYALMVGGDEADIARVQPVFDALKPAGDSGFVHAGGVGAGHFS
FT                   KMVHNGIEYGIMQSYAEGWELLEAAPNVTNVREVFRSWQEGTVIRSWLLDLLVRALDDD
FT                   EHLAGIRGYADDSGEGRWTVEAGIDMAVPTPAITASLYARFTSRQEDSPQMKAIAALRN
FT                   QFGGHAVKKES"
     MEIGLVGLGK MGGNMRERIR QAGHTVVGYD RDPKLADVGS LKELVQTLAA PRVIWIMVPA        60
     GEATDATVNE LADLLHTGDM VIDGGNSRWT EDIKHAELLK AQGVAFVDAG VSGGVWGLQN       120
     GYALMVGGDE ADIARVQPVF DALKPAGDSG FVHAGGVGAG HFSKMVHNGI EYGIMQSYAE       180
     GWELLEAAPN VTNVREVFRS WQEGTVIRSW LLDLLVRALD DDEHLAGIRG YADDSGEGRW       240
     TVEAGIDMAV PTPAITASLY ARFTSRQEDS PQMKAIAALR NQFGGHAVKK ES               292
//

If you have problems or comments...

PBIL Back to PBIL home page