(data stored in ACNUC7421 zone)

EMBL: CP001700.PE300

CP001700.PE300       Location/Qualifiers
FT   CDS             complement(340009..341532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0302"
FT                   /product="Lysozyme"
FT                   /EC_number="3.2.1.17"
FT                   /note="KEGG: fre:Franean1_6988 lysozyme; PFAM:
FT                   cellulose-binding family II; SMART: cellulose-binding
FT                   family II"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69255"
FT                   /db_xref="GOA:C7QJB3"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB3"
FT                   /inference="protein motif:PRIAM:3.2.1.17"
FT                   /protein_id="ACU69255.1"
FT                   /translation="MGLSKRARVIGISLATAAVVGAGAVAAFSAGAAGSSSGSVTAAFA
FT                   KTSDWGTGFQGQYTIANSTGQTVHGWTVSFDLPSGERISSLWNGTMTAAGQHITVANPT
FT                   WAGDIATGTSATFGFVVDATSGSTAPQNCLVNGASCDGGTPGGGQSSAPGGAPSTAPGS
FT                   SSAPSSAPSSAPSSVPSSAPSSAPSSAPSSVPPPPASSGSYSFAPYVDTSQRQDLGAIA
FT                   TAAGAKDVTAAFMLAGGSGCTPAWNGSADAGFEGALKAGVADLRAKGGDVIASFGGANG
FT                   TELAGACKDVPSLKAAYKSVIDAYNLTHVDFDIEGAATTDQASITRRAQALAQLQADYA
FT                   AAGKTLDVSLTLPVLPSGLTQDGVNIVTAAATNNLKISVVNVMAMDFGDWAAPSPSGKM
FT                   GQYADQSAQSVHDQLKSVYPGATDAQLWSMVGITPMIGVNDTSDEVFQVSDASVVEQFA
FT                   AQHHIGRLAMWSLTRDQACAQPSSWASPTCSSIQQNTYDFAHTFEAFTG"
     MGLSKRARVI GISLATAAVV GAGAVAAFSA GAAGSSSGSV TAAFAKTSDW GTGFQGQYTI        60
     ANSTGQTVHG WTVSFDLPSG ERISSLWNGT MTAAGQHITV ANPTWAGDIA TGTSATFGFV       120
     VDATSGSTAP QNCLVNGASC DGGTPGGGQS SAPGGAPSTA PGSSSAPSSA PSSAPSSVPS       180
     SAPSSAPSSA PSSVPPPPAS SGSYSFAPYV DTSQRQDLGA IATAAGAKDV TAAFMLAGGS       240
     GCTPAWNGSA DAGFEGALKA GVADLRAKGG DVIASFGGAN GTELAGACKD VPSLKAAYKS       300
     VIDAYNLTHV DFDIEGAATT DQASITRRAQ ALAQLQADYA AAGKTLDVSL TLPVLPSGLT       360
     QDGVNIVTAA ATNNLKISVV NVMAMDFGDW AAPSPSGKMG QYADQSAQSV HDQLKSVYPG       420
     ATDAQLWSMV GITPMIGVND TSDEVFQVSD ASVVEQFAAQ HHIGRLAMWS LTRDQACAQP       480
     SSWASPTCSS IQQNTYDFAH TFEAFTG                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page