(data stored in ACNUC7421 zone)

EMBL: CP001700.PE301

CP001700.PE301       Location/Qualifiers
FT   CDS             complement(341687..342703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0303"
FT                   /product="cytochrome bd ubiquinol oxidase subunit II"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit II;
FT                   KEGG: fre:Franean1_6579 cytochrome d ubiquinol oxidase
FT                   subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69256"
FT                   /db_xref="GOA:C7QJB4"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB4"
FT                   /inference="protein motif:PFAM:PF02322"
FT                   /protein_id="ACU69256.1"
FT                   /translation="MTAVDLLLGVIVCALAAYALLAGADFGAGVWDLLARGRHADRERR
FT                   LIAHALGPVWEANHVWLIFVIVATFSGFPTAFGIIARGLELPLALALAGIVLRGAAYVY
FT                   RAYGEGAAGPDSLWSRVFAVASSITPFMLGVSGAALATGKITATSGPLTPFDSPFTLVA
FT                   GVFAVVVTAFLAAVYLCHDAGTDPETEDLVPAFRRRALGAAAVAGVVSMALLPLLYQDA
FT                   PIVAHRFTERSIPFVAVAVVCGFGSLAVIWKRHYVLARATAATAVIGVLLGWAAAQYPD
FT                   LAVGAATARGSAAGPANLHALLIAMGFGMVVILPAFYLLLKVFSGPEGAAGGSGLAN"
     MTAVDLLLGV IVCALAAYAL LAGADFGAGV WDLLARGRHA DRERRLIAHA LGPVWEANHV        60
     WLIFVIVATF SGFPTAFGII ARGLELPLAL ALAGIVLRGA AYVYRAYGEG AAGPDSLWSR       120
     VFAVASSITP FMLGVSGAAL ATGKITATSG PLTPFDSPFT LVAGVFAVVV TAFLAAVYLC       180
     HDAGTDPETE DLVPAFRRRA LGAAAVAGVV SMALLPLLYQ DAPIVAHRFT ERSIPFVAVA       240
     VVCGFGSLAV IWKRHYVLAR ATAATAVIGV LLGWAAAQYP DLAVGAATAR GSAAGPANLH       300
     ALLIAMGFGM VVILPAFYLL LKVFSGPEGA AGGSGLAN                               338
//

If you have problems or comments...

PBIL Back to PBIL home page