(data stored in ACNUC7421 zone)

EMBL: CP001700.PE302

CP001700.PE302       Location/Qualifiers
FT   CDS             complement(342700..344181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0304"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: fre:Franean1_6580 cytochrome bd ubiquinol oxidase
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69257"
FT                   /db_xref="GOA:C7QJB5"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB5"
FT                   /inference="protein motif:PFAM:PF01654"
FT                   /protein_id="ACU69257.1"
FT                   /translation="MLGSSLSDARIETGFSLAFHIVFAVFGVGLPWLLLVTEGRWLKTR
FT                   DPVWLALTRKWSRVMAVLFAIGAVSGTVLSFEFGLLWPAFMARYGGVLGLPFTLEAFAF
FT                   FAEAIFVGLYLYGWKRLSPRAHWLTLWPIAISGTLSTLFIVTANSWMNVPTGVKEVGGK
FT                   VVSAEPLAPLTGPGALPESLHMLLAAIMCTGGVVAAVYAVGMLRGRRDSYHRRGFRVGL
FT                   VTVLAAAPLQLVVGDLAARVVEKYQPAKLAAMEALTHTQSHAPLTLGGIYDPSTGKTRF
FT                   GIEIPDGLSLLTGFRTDKTIRGLDILPAKQQPATPVVHLAFDTMVGGGMAILGLAGLLA
FT                   VVALWRRRKGVRPLIPLTRPWLLAGALTGPAAMAAMLAGWEVTEAGRQPWIVYGRMTVR
FT                   QAATTSGGIGWSLIATIAVYLGLATALLLILRRLATGAPPELAEGAEPSGPQDPESPTH
FT                   EPSGSEGDAEDSPESTETNAESTPESSPELEGAAR"
     MLGSSLSDAR IETGFSLAFH IVFAVFGVGL PWLLLVTEGR WLKTRDPVWL ALTRKWSRVM        60
     AVLFAIGAVS GTVLSFEFGL LWPAFMARYG GVLGLPFTLE AFAFFAEAIF VGLYLYGWKR       120
     LSPRAHWLTL WPIAISGTLS TLFIVTANSW MNVPTGVKEV GGKVVSAEPL APLTGPGALP       180
     ESLHMLLAAI MCTGGVVAAV YAVGMLRGRR DSYHRRGFRV GLVTVLAAAP LQLVVGDLAA       240
     RVVEKYQPAK LAAMEALTHT QSHAPLTLGG IYDPSTGKTR FGIEIPDGLS LLTGFRTDKT       300
     IRGLDILPAK QQPATPVVHL AFDTMVGGGM AILGLAGLLA VVALWRRRKG VRPLIPLTRP       360
     WLLAGALTGP AAMAAMLAGW EVTEAGRQPW IVYGRMTVRQ AATTSGGIGW SLIATIAVYL       420
     GLATALLLIL RRLATGAPPE LAEGAEPSGP QDPESPTHEP SGSEGDAEDS PESTETNAES       480
     TPESSPELEG AAR                                                          493
//

If you have problems or comments...

PBIL Back to PBIL home page