(data stored in ACNUC7421 zone)

EMBL: CP001700.PE304

CP001700.PE304       Location/Qualifiers
FT   CDS             345021..345965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0306"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: aau:AAur_1766 M48
FT                   family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69259"
FT                   /db_xref="GOA:C7QJB7"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB7"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ACU69259.1"
FT                   /translation="MFADAWPLAVLAILLAWPVPVFLARAAWPRRHARAAIALWQAVGV
FT                   AGGLALIGAPLAVGVAPLDGHLRTGLVELWRDAFHLRVPAALGLAQEIALALAAVLTVR
FT                   LVGVTLLSAWRIERDLRRQRDAVDLAAEHADRDLRVLEHAAPAAYCLPGTRPRIVITEG
FT                   TIAALAPDELEAVLAHERAHARWRHELVVQPFVAWESALPLPPARRATASVTALVEMLA
FT                   DDHAARSVGRPALARALVAIGGTAGPVPNQRTDGAPGSGSDPNPVRATPTLDRVQRLVR
FT                   RPKATSLAERLIGPAAWLAAVLLVAGPTWYVLR"
     MFADAWPLAV LAILLAWPVP VFLARAAWPR RHARAAIALW QAVGVAGGLA LIGAPLAVGV        60
     APLDGHLRTG LVELWRDAFH LRVPAALGLA QEIALALAAV LTVRLVGVTL LSAWRIERDL       120
     RRQRDAVDLA AEHADRDLRV LEHAAPAAYC LPGTRPRIVI TEGTIAALAP DELEAVLAHE       180
     RAHARWRHEL VVQPFVAWES ALPLPPARRA TASVTALVEM LADDHAARSV GRPALARALV       240
     AIGGTAGPVP NQRTDGAPGS GSDPNPVRAT PTLDRVQRLV RRPKATSLAE RLIGPAAWLA       300
     AVLLVAGPTW YVLR                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page