(data stored in ACNUC7421 zone)

EMBL: CP001700.PE305

CP001700.PE305       Location/Qualifiers
FT   CDS             complement(346002..347297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0307"
FT                   /product="Aspartyl aminopeptidase"
FT                   /EC_number="3.4.11.21"
FT                   /note="PFAM: peptidase M18 aminopeptidase I; KEGG:
FT                   sgr:SGR_3783 putative aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69260"
FT                   /db_xref="GOA:C7QJB8"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB8"
FT                   /inference="protein motif:PRIAM:3.4.11.21"
FT                   /protein_id="ACU69260.1"
FT                   /translation="MPIFDRAHTDDLLAFLAASPTPYHAVTNAAARLEAAGFRQLRQSA
FT                   GWESADGGGFYAIRGAAIIAWYLPEGAAAPTGFRVVGAHTDSPNLRVKPLPDTGSAGFR
FT                   QVAVELYGGPLLNSWLDRDLGLAGRLVLRGGEAALVHVDRALMRVPQLAVHLDRGVNDS
FT                   GLLLDKQQHLTPAWGLGPVEDGALIEFAAKEAGVSASDVMGFDLMLHDVTPPTYLGRDQ
FT                   EMIAAPRMDNLVSVHAGVQALIAAASGAGGPLTAIPVLAAFDHEETGSESDTGAGGPLL
FT                   GTILSRVTQAQLGGSADDYARALAATVVMSSDMSHAVHPNYPERHEPGHRPRLNGGPAL
FT                   KTNVNQRYATDGLGRAIWTDVCERAGIPTQYFVGKNSLPCGTTIGPITAAKLGVTTFDV
FT                   GITSLSMHSAREMGGADDPFLLASAAASFFAG"
     MPIFDRAHTD DLLAFLAASP TPYHAVTNAA ARLEAAGFRQ LRQSAGWESA DGGGFYAIRG        60
     AAIIAWYLPE GAAAPTGFRV VGAHTDSPNL RVKPLPDTGS AGFRQVAVEL YGGPLLNSWL       120
     DRDLGLAGRL VLRGGEAALV HVDRALMRVP QLAVHLDRGV NDSGLLLDKQ QHLTPAWGLG       180
     PVEDGALIEF AAKEAGVSAS DVMGFDLMLH DVTPPTYLGR DQEMIAAPRM DNLVSVHAGV       240
     QALIAAASGA GGPLTAIPVL AAFDHEETGS ESDTGAGGPL LGTILSRVTQ AQLGGSADDY       300
     ARALAATVVM SSDMSHAVHP NYPERHEPGH RPRLNGGPAL KTNVNQRYAT DGLGRAIWTD       360
     VCERAGIPTQ YFVGKNSLPC GTTIGPITAA KLGVTTFDVG ITSLSMHSAR EMGGADDPFL       420
     LASAAASFFA G                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page