(data stored in ACNUC7421 zone)

EMBL: CP001700.PE306

CP001700.PE306       Location/Qualifiers
FT   CDS             complement(347404..349626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0308"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: nca:Noca_3656 MmpL
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69261"
FT                   /db_xref="GOA:C7QJB9"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJB9"
FT                   /inference="protein motif:PFAM:PF03176"
FT                   /protein_id="ACU69261.1"
FT                   /translation="MFGRLGRFVVHNPWKIIVGWIIAAVALVAFGPQLSSVTNDNQSSF
FT                   LPSKYESVQAKNALDAEFPSTVGQVATIVIRPVGDGALSAAEQQKVSDLATTLTGDHIT
FT                   GVAGVQAGQVSPKQTAQLMFAKLTADQGDQKASSDAVKALRADLAAKLNGSGMKAEVTG
FT                   DAAMGLDTSDSSNKATGIVMMATLLLIIVLMGFIFRGVIAVLLPILSVFLVMMVSQPVI
FT                   ALMAKGFGLHVQSFLEIMLVVVLFGIGTDYIVFLLFRLRERLRAGDTIQQAVATTVERV
FT                   GEAIASAAAAVIIAFCALGLATFKAFTSLGPALAIAVAVMLLAGLTLVPALMVTLGTKI
FT                   FWPGKKWRRVPTAGPARKVGNLVGKRPAAVAAVSFVIMAGLAVGAVGFKADYDQQSQMP
FT                   GGVESTIAIKDMQKAGFAQGATAATDVIVTSTDGKPLDQAKLQTYADGLGAASPELSGL
FT                   MPFPVKPGSPAGTKGATVEYNQAGTAAHIQVLTKDSPFAAAAMSAVDGPLKSAAHSTVP
FT                   AGAKALVGGGTAALSDIQAANNSDLALILPVAGLLIFLVLALQLRALVAPLYLMVAVGL
FT                   GYTGTLGASVLMFQTVQNKPGMMFMLPVMVYLFVVAIGTDYNILMISRLREEAREGHDP
FT                   RRAAALAVEHAGPSVASAGLILAGTFASLMLGGLAMMQQIGFAVSFGISIAAFVMSMFL
FT                   VPAVTALMGAKAWWPGHKGVASATAGVGRPVVSDLDDEVVGAGAHR"
     MFGRLGRFVV HNPWKIIVGW IIAAVALVAF GPQLSSVTND NQSSFLPSKY ESVQAKNALD        60
     AEFPSTVGQV ATIVIRPVGD GALSAAEQQK VSDLATTLTG DHITGVAGVQ AGQVSPKQTA       120
     QLMFAKLTAD QGDQKASSDA VKALRADLAA KLNGSGMKAE VTGDAAMGLD TSDSSNKATG       180
     IVMMATLLLI IVLMGFIFRG VIAVLLPILS VFLVMMVSQP VIALMAKGFG LHVQSFLEIM       240
     LVVVLFGIGT DYIVFLLFRL RERLRAGDTI QQAVATTVER VGEAIASAAA AVIIAFCALG       300
     LATFKAFTSL GPALAIAVAV MLLAGLTLVP ALMVTLGTKI FWPGKKWRRV PTAGPARKVG       360
     NLVGKRPAAV AAVSFVIMAG LAVGAVGFKA DYDQQSQMPG GVESTIAIKD MQKAGFAQGA       420
     TAATDVIVTS TDGKPLDQAK LQTYADGLGA ASPELSGLMP FPVKPGSPAG TKGATVEYNQ       480
     AGTAAHIQVL TKDSPFAAAA MSAVDGPLKS AAHSTVPAGA KALVGGGTAA LSDIQAANNS       540
     DLALILPVAG LLIFLVLALQ LRALVAPLYL MVAVGLGYTG TLGASVLMFQ TVQNKPGMMF       600
     MLPVMVYLFV VAIGTDYNIL MISRLREEAR EGHDPRRAAA LAVEHAGPSV ASAGLILAGT       660
     FASLMLGGLA MMQQIGFAVS FGISIAAFVM SMFLVPAVTA LMGAKAWWPG HKGVASATAG       720
     VGRPVVSDLD DEVVGAGAHR                                                   740
//

If you have problems or comments...

PBIL Back to PBIL home page