(data stored in ACNUC7421 zone)

EMBL: CP001700.PE307

CP001700.PE307       Location/Qualifiers
FT   CDS             349752..350393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0309"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sen:SACE_6185
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69262"
FT                   /db_xref="GOA:C7QJC0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJC0"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69262.1"
FT                   /translation="MRRNSQSEHDPGGTKERIQHVALELFVLHGYEKTSLREISDRLGI
FT                   TKAALYYHYASKQELLKSVTQPLIDEFELLVAGDPDPETLLRSYVDLLHRHQAVFQLVA
FT                   NDHASLAAAELVERSVKLRRDVVRRLAGPEPQPADYIRAAAAFGAISQGFMLARRVEPA
FT                   ADPALPDVEATAEKAAETAAGLPAPADYPEGAELTRILMDTALAVLRSGS"
     MRRNSQSEHD PGGTKERIQH VALELFVLHG YEKTSLREIS DRLGITKAAL YYHYASKQEL        60
     LKSVTQPLID EFELLVAGDP DPETLLRSYV DLLHRHQAVF QLVANDHASL AAAELVERSV       120
     KLRRDVVRRL AGPEPQPADY IRAAAAFGAI SQGFMLARRV EPAADPALPD VEATAEKAAE       180
     TAAGLPAPAD YPEGAELTRI LMDTALAVLR SGS                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page