(data stored in ACNUC7421 zone)

EMBL: CP001700.PE308

CP001700.PE308       Location/Qualifiers
FT   CDS             350452..351315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0310"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR substrate-
FT                   binding; KEGG: tfu:Tfu_2825 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69263"
FT                   /db_xref="GOA:C7QJC1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJC1"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACU69263.1"
FT                   /translation="MDLALLRTFLAVHRAGSLTRAAADLGVSQPAVTAQVRTLEQRVGR
FT                   ELFVRLPRGVAPTAAADELARAIAPHLDALAAVAHETLVPDSGPLAAVRLGCPASLTTT
FT                   LLLPALAPLVDEGLRVVVAGGRSDDLVAQLATGRLDLTLAVTRPRLPGVTVIPLADEEY
FT                   ALVGAPRWKPFDRTGRTPLLDLSENLPYISLYWSSVYDTRPTSDAALVIPDLRGVLDAA
FT                   VAGCGAAVLPLPLCAPALDDWTLVLLDEPEIPPIRTLFVAVRGQRARSAAVARVRDRLV
FT                   AVASRW"
     MDLALLRTFL AVHRAGSLTR AAADLGVSQP AVTAQVRTLE QRVGRELFVR LPRGVAPTAA        60
     ADELARAIAP HLDALAAVAH ETLVPDSGPL AAVRLGCPAS LTTTLLLPAL APLVDEGLRV       120
     VVAGGRSDDL VAQLATGRLD LTLAVTRPRL PGVTVIPLAD EEYALVGAPR WKPFDRTGRT       180
     PLLDLSENLP YISLYWSSVY DTRPTSDAAL VIPDLRGVLD AAVAGCGAAV LPLPLCAPAL       240
     DDWTLVLLDE PEIPPIRTLF VAVRGQRARS AAVARVRDRL VAVASRW                     287
//

If you have problems or comments...

PBIL Back to PBIL home page