(data stored in ACNUC7421 zone)

EMBL: CP001700.PE309

CP001700.PE309       Location/Qualifiers
FT   CDS             351679..352761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0311"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   sgr:SGR_1348 putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69264"
FT                   /db_xref="GOA:C7QJC2"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJC2"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ACU69264.1"
FT                   /translation="MTWELPAQGQAQEATQAIPAQNGSLNPDSLNPEVYASLFRPEGAP
FT                   ARANPNATQVMPSVPDDYGRPGYDQDGYPQAGYDQRAANQPAYDQPIDYQAAGGGAYAE
FT                   PYETGYADDYPDEPSARPSNRGTKIGIGVAAGAVLVIVISLITLGGGSSKPSAGPANTP
FT                   GTVTTPTVPPSTSAPQVAASDPATSTPSSPASSTSHAPGTLQLGDSGAEVKWLQTRLHQ
FT                   LGVYNGPINSKFDAATQAAVAAFQAKTHASDPAGVVGRSTKTALIAAGSKPTLMGQVPN
FT                   LPGGPLGGDKHHRGNNPADVKRLQQALAVALNTNLKATGQFDLDTFGAVVQYQGAMHMT
FT                   PDGLVNGTVWAALQQGRISG"
     MTWELPAQGQ AQEATQAIPA QNGSLNPDSL NPEVYASLFR PEGAPARANP NATQVMPSVP        60
     DDYGRPGYDQ DGYPQAGYDQ RAANQPAYDQ PIDYQAAGGG AYAEPYETGY ADDYPDEPSA       120
     RPSNRGTKIG IGVAAGAVLV IVISLITLGG GSSKPSAGPA NTPGTVTTPT VPPSTSAPQV       180
     AASDPATSTP SSPASSTSHA PGTLQLGDSG AEVKWLQTRL HQLGVYNGPI NSKFDAATQA       240
     AVAAFQAKTH ASDPAGVVGR STKTALIAAG SKPTLMGQVP NLPGGPLGGD KHHRGNNPAD       300
     VKRLQQALAV ALNTNLKATG QFDLDTFGAV VQYQGAMHMT PDGLVNGTVW AALQQGRISG       360
//

If you have problems or comments...

PBIL Back to PBIL home page