(data stored in ACNUC7421 zone)

EMBL: CP001700.PE31

CP001700.PE31        Location/Qualifiers
FT   CDS             30640..31470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0031"
FT                   /product="putative integral membrane protein"
FT                   /note="KEGG: sgr:SGR_5473 putative integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68986"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP7"
FT                   /inference="similar to AA sequence:KEGG:SGR_5473"
FT                   /protein_id="ACU68986.1"
FT                   /translation="MTDEAWENGLREVMTGAAGSTRVAPPPTDAILRGGRSSLRLRNGL
FT                   TGSGVLGMVAAAVIVGTSFGGGATVGSVQQAGTTSTSAQPPQAQDAAVTLGPASAKTKV
FT                   VVYEDYRCPPCRDVEAGTSAYLTEEADSGKIQVEYRAVNLIDRNGQTSGSGSTAAGNAV
FT                   QCAADRGDFSAYRSAVYAHQPQENLDAFTSSALLITIARTIPGLDTAAFEKCVDDQPYA
FT                   AAISSNYTRAFTTAHCTGVPCISVDGQQWTGSIPEGADVGKIINAWLAQKISAA"
     MTDEAWENGL REVMTGAAGS TRVAPPPTDA ILRGGRSSLR LRNGLTGSGV LGMVAAAVIV        60
     GTSFGGGATV GSVQQAGTTS TSAQPPQAQD AAVTLGPASA KTKVVVYEDY RCPPCRDVEA       120
     GTSAYLTEEA DSGKIQVEYR AVNLIDRNGQ TSGSGSTAAG NAVQCAADRG DFSAYRSAVY       180
     AHQPQENLDA FTSSALLITI ARTIPGLDTA AFEKCVDDQP YAAAISSNYT RAFTTAHCTG       240
     VPCISVDGQQ WTGSIPEGAD VGKIINAWLA QKISAA                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page