(data stored in ACNUC7421 zone)

EMBL: CP001700.PE310

CP001700.PE310       Location/Qualifiers
FT   CDS             complement(352923..353228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0312"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbt:CLH_2449 TfoX C-domain superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69265"
FT                   /db_xref="InterPro:IPR007077"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVA9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69265.1"
FT                   /translation="MSSTETVTLIQNAVNIGPVLTQRLRDVGVTTLDEVRERGAIEVWQ
FT                   LIAHTAEGNECAHMLLALEGALRGQRWTSIPRSERDALLVEVGLKDASELRAPKKR"
     MSSTETVTLI QNAVNIGPVL TQRLRDVGVT TLDEVRERGA IEVWQLIAHT AEGNECAHML        60
     LALEGALRGQ RWTSIPRSER DALLVEVGLK DASELRAPKK R                           101
//

If you have problems or comments...

PBIL Back to PBIL home page