(data stored in ACNUC7421 zone)

EMBL: CP001700.PE311

CP001700.PE311       Location/Qualifiers
FT   CDS             complement(353306..353719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0313"
FT                   /product="Mov34/MPN/PAD-1 family protein"
FT                   /note="PFAM: Mov34/MPN/PAD-1 family protein; SMART:
FT                   Mov34/MPN/PAD-1 family protein; KEGG: tfu:Tfu_2370
FT                   Mov34/MPN/PAD-1"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69266"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB0"
FT                   /inference="protein motif:PFAM:PF01398"
FT                   /protein_id="ACU69266.1"
FT                   /translation="MLTVSQEIYDAIVAHARRDHPDEACGIVAGPEGSDRPERFVPMAN
FT                   AERSPTFYRLDPAEQFKVWREMDDRDEEPVIVYHSHTSTEARPSRTDISYASEPNAHYV
FT                   LVSTRDTDKLGDFQFRSFRIVDGEVTEEPVTVL"
     MLTVSQEIYD AIVAHARRDH PDEACGIVAG PEGSDRPERF VPMANAERSP TFYRLDPAEQ        60
     FKVWREMDDR DEEPVIVYHS HTSTEARPSR TDISYASEPN AHYVLVSTRD TDKLGDFQFR       120
     SFRIVDGEVT EEPVTVL                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page