(data stored in ACNUC7421 zone)

EMBL: CP001700.PE312

CP001700.PE312       Location/Qualifiers
FT   CDS             353797..355236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0314"
FT                   /product="sugar transporter"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: sgr:SGR_1900 putative glucose transporter;
FT                   TIGRFAM: sugar transporter; PFAM: General substrate
FT                   transporter; major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69267"
FT                   /db_xref="GOA:C7PVB1"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB1"
FT                   /inference="protein motif:TFAM:TIGR00879"
FT                   /protein_id="ACU69267.1"
FT                   /translation="MTTRTGRESGPNPPGDSAAARVAPRIVFIAAAAALGGFLFGYDSA
FT                   VINGAVTGIQHDFNVGSGTTGFVVAAALPGAAAGAIAGGWMADRIGRIRAMQIAAVLFI
FT                   ISGIGSMFAFQPWDLTIWRILGGFAIGIASVIGPAYIAEVSPPAFRGRLTSFQQLAIVL
FT                   GIAISALVNYLINQWAGGTNTDHLGGLAAWRWMLGAEVIPAILYGVLSTMIPESPRFLV
FT                   ANGEDDRAREVLAEVEGTHANVADRIAEIRDQLAGEVKPKLADLLTPSRKNLLAVVWIG
FT                   IGLSVLQQFVGINVIFYYSSLLWQSVGIDTSNSLLISMISAAVNIAGTVVAMALVDRIG
FT                   RRPLLLIGSVGMAVTLGLCAWMFSYGTHANGKTTLPKAQGVTALLGANAYVFFFAMSWG
FT                   VVVWVLLGEMFPNRIRAVALSVAASAQWLANWLVTVSFPSLSRWSLAGAYSLYAIAAAV
FT                   SIPFVYYLVRETKGKTLESMG"
     MTTRTGRESG PNPPGDSAAA RVAPRIVFIA AAAALGGFLF GYDSAVINGA VTGIQHDFNV        60
     GSGTTGFVVA AALPGAAAGA IAGGWMADRI GRIRAMQIAA VLFIISGIGS MFAFQPWDLT       120
     IWRILGGFAI GIASVIGPAY IAEVSPPAFR GRLTSFQQLA IVLGIAISAL VNYLINQWAG       180
     GTNTDHLGGL AAWRWMLGAE VIPAILYGVL STMIPESPRF LVANGEDDRA REVLAEVEGT       240
     HANVADRIAE IRDQLAGEVK PKLADLLTPS RKNLLAVVWI GIGLSVLQQF VGINVIFYYS       300
     SLLWQSVGID TSNSLLISMI SAAVNIAGTV VAMALVDRIG RRPLLLIGSV GMAVTLGLCA       360
     WMFSYGTHAN GKTTLPKAQG VTALLGANAY VFFFAMSWGV VVWVLLGEMF PNRIRAVALS       420
     VAASAQWLAN WLVTVSFPSL SRWSLAGAYS LYAIAAAVSI PFVYYLVRET KGKTLESMG        479
//

If you have problems or comments...

PBIL Back to PBIL home page