(data stored in ACNUC7421 zone)

EMBL: CP001700.PE313

CP001700.PE313       Location/Qualifiers
FT   CDS             355276..355788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0315"
FT                   /product="TPR repeat-containing protein"
FT                   /note="KEGG: stp:Strop_3309 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69268"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB2"
FT                   /inference="similar to AA sequence:KEGG:Strop_3309"
FT                   /protein_id="ACU69268.1"
FT                   /translation="MGLDFRTDPETLREIVDDPAALAARIHTLAALDMDEHPEARSEYA
FT                   TLLRIAGRLDDAALEAELTLAAADLAGDLRRMVRATLLVGHVRQYRGEWDQADTMFHRA
FT                   EKLALYLKDDRLVAAAAHHSGRSFYDQGKHVEAALRFRLALEIDTRIGSPKVSAVWEAF
FT                   EAAMAKL"
     MGLDFRTDPE TLREIVDDPA ALAARIHTLA ALDMDEHPEA RSEYATLLRI AGRLDDAALE        60
     AELTLAAADL AGDLRRMVRA TLLVGHVRQY RGEWDQADTM FHRAEKLALY LKDDRLVAAA       120
     AHHSGRSFYD QGKHVEAALR FRLALEIDTR IGSPKVSAVW EAFEAAMAKL                  170
//

If you have problems or comments...

PBIL Back to PBIL home page