(data stored in ACNUC7421 zone)

EMBL: CP001700.PE314

CP001700.PE314       Location/Qualifiers
FT   CDS             complement(355850..356605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0316"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: sgr:SGR_5042 putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69269"
FT                   /db_xref="GOA:C7PVB3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB3"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACU69269.1"
FT                   /translation="MLDYDLEAARYDQTRGGVERARAAADAVLELVPKDCAVLLDVACG
FT                   TGIVSELLRTPDRTVIGVDMAAGMLALARPRLGGTGRAVRGDATRLPLASGAVDAVTFM
FT                   WLLHLVDEAVVAAAVAEAARVLRPGGVMVTTVDKDSAQFGMNTDVGAIMRAARQELAPP
FT                   ASDQAERVRELAAAVGLEAAGTARYVGHGQGQTPKAWARRLREQAGWARRADPARIAEI
FT                   CRALEALPEQDVRRPDPEYVVASFRLDGH"
     MLDYDLEAAR YDQTRGGVER ARAAADAVLE LVPKDCAVLL DVACGTGIVS ELLRTPDRTV        60
     IGVDMAAGML ALARPRLGGT GRAVRGDATR LPLASGAVDA VTFMWLLHLV DEAVVAAAVA       120
     EAARVLRPGG VMVTTVDKDS AQFGMNTDVG AIMRAARQEL APPASDQAER VRELAAAVGL       180
     EAAGTARYVG HGQGQTPKAW ARRLREQAGW ARRADPARIA EICRALEALP EQDVRRPDPE       240
     YVVASFRLDG H                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page