(data stored in ACNUC7421 zone)

EMBL: CP001700.PE315

CP001700.PE315       Location/Qualifiers
FT   CDS             356752..357615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0317"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   sma:SAV_7083 Rif11-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69270"
FT                   /db_xref="GOA:C7PVB4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019923"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB4"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACU69270.1"
FT                   /translation="MHPRTFRFAVVAALAPTAQAWQELARRAEELGYDTLLAPDTMTTL
FT                   EPFTALAAAATATERLRVGTFVLPAPFYPPSEIAWRALALDLLSGGRFDLGLGAGRPGA
FT                   EDEVVHRERRFGTPAERVKQLSDALHIVKEELAAAAAGRSPLKPVQKPHPPILVAAAGP
FT                   KMFQLAAAEADILTLGLDPRTTEDGLAAKIAELRAIAGSRVDDLELSYNLAGVGTELPG
FT                   FLSQQMGVDPAELIRTGAPAVLTGTPQEMADKLRRRRDTLGISYIAVNGMFLEQLAPVV
FT                   EMLAGK"
     MHPRTFRFAV VAALAPTAQA WQELARRAEE LGYDTLLAPD TMTTLEPFTA LAAAATATER        60
     LRVGTFVLPA PFYPPSEIAW RALALDLLSG GRFDLGLGAG RPGAEDEVVH RERRFGTPAE       120
     RVKQLSDALH IVKEELAAAA AGRSPLKPVQ KPHPPILVAA AGPKMFQLAA AEADILTLGL       180
     DPRTTEDGLA AKIAELRAIA GSRVDDLELS YNLAGVGTEL PGFLSQQMGV DPAELIRTGA       240
     PAVLTGTPQE MADKLRRRRD TLGISYIAVN GMFLEQLAPV VEMLAGK                     287
//

If you have problems or comments...

PBIL Back to PBIL home page