(data stored in ACNUC7421 zone)

EMBL: CP001700.PE316

CP001700.PE316       Location/Qualifiers
FT   CDS             complement(357646..358143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0318"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   fre:Franean1_4116 HxlR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69271"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB5"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACU69271.1"
FT                   /translation="MQAIRYTGRMLGKTYDSQVCSIARALEVVGERWSLLIVRDALFGG
FT                   ATRYSDFQRSLGIATNVLKTRLDGLVETGVMRRHQYSQQREQYEYLLTDKGRALAHSLV
FT                   ALSEWGDQWATDGEPPILYVHSVCGTGVTQKTVCAHCGVVEDPAEIRAEIGPGMPADRI
FT                   PA"
     MQAIRYTGRM LGKTYDSQVC SIARALEVVG ERWSLLIVRD ALFGGATRYS DFQRSLGIAT        60
     NVLKTRLDGL VETGVMRRHQ YSQQREQYEY LLTDKGRALA HSLVALSEWG DQWATDGEPP       120
     ILYVHSVCGT GVTQKTVCAH CGVVEDPAEI RAEIGPGMPA DRIPA                       165
//

If you have problems or comments...

PBIL Back to PBIL home page