(data stored in ACNUC7421 zone)

EMBL: CP001700.PE317

CP001700.PE317       Location/Qualifiers
FT   CDS             358175..358705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0319"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_4690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69272"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69272.1"
FT                   /translation="MMQATAEQQQRPYTTGFTVARTPRAAYDAVLDVRGWWSAAVEGVT
FT                   DQVGGVFDYRFQDVHRCKVRVAELVPEQKVVWHVEENYFNFIADQTEWTGTDIVFEISP
FT                   APDGGAEIRFTHIGLLPQDECYDVCSNAWGGYIAGSLRALIETGQGHPNPKHDGDAPSH
FT                   QDAASAIRAERRP"
     MMQATAEQQQ RPYTTGFTVA RTPRAAYDAV LDVRGWWSAA VEGVTDQVGG VFDYRFQDVH        60
     RCKVRVAELV PEQKVVWHVE ENYFNFIADQ TEWTGTDIVF EISPAPDGGA EIRFTHIGLL       120
     PQDECYDVCS NAWGGYIAGS LRALIETGQG HPNPKHDGDA PSHQDAASAI RAERRP           176
//

If you have problems or comments...

PBIL Back to PBIL home page