(data stored in ACNUC7421 zone)

EMBL: CP001700.PE318

CP001700.PE318       Location/Qualifiers
FT   CDS             complement(358702..359427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0320"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69273"
FT                   /db_xref="GOA:C7PVB7"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB7"
FT                   /inference="protein motif:PFAM:PF05721"
FT                   /protein_id="ACU69273.1"
FT                   /translation="MLSTEQLKEFGERGYVVVPGVVARNVVAKANKRIDELIAANPPAQ
FT                   GQVGHHFYFPAAADEPELLETLMDSAFGYAEALTGPGLLETPQQVQVALNIPPFSHRPG
FT                   RPHIDAAISEPTPGFTPNSFTLLAGVFVTDQLRENSGNLWVWPGTHRTHAEYFRERGIE
FT                   MYCAYPDIELPEPEQVTARAGDLLLAHYLLGHNIGGNYESDTTRRMLYYRVSGRGHAEG
FT                   PERILTEPWYEYGPVRALI"
     MLSTEQLKEF GERGYVVVPG VVARNVVAKA NKRIDELIAA NPPAQGQVGH HFYFPAAADE        60
     PELLETLMDS AFGYAEALTG PGLLETPQQV QVALNIPPFS HRPGRPHIDA AISEPTPGFT       120
     PNSFTLLAGV FVTDQLRENS GNLWVWPGTH RTHAEYFRER GIEMYCAYPD IELPEPEQVT       180
     ARAGDLLLAH YLLGHNIGGN YESDTTRRML YYRVSGRGHA EGPERILTEP WYEYGPVRAL       240
     I                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page