(data stored in ACNUC7421 zone)

EMBL: CP001700.PE319

CP001700.PE319       Location/Qualifiers
FT   CDS             complement(359470..360339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0321"
FT                   /product="fatty acid hydroxylase"
FT                   /note="PFAM: fatty acid hydroxylase; KEGG: nfa:nfa16290
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69274"
FT                   /db_xref="GOA:C7PVB8"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB8"
FT                   /inference="protein motif:PFAM:PF04116"
FT                   /protein_id="ACU69274.1"
FT                   /translation="MRLVIDGIDLTTLAIPFYVLFMALELLSLRFFPDPVEQGYTVKDT
FT                   ATSLTMGIGSIVCNLGWGLVTVAAVAGVHALAPWHIASSLTGWLVLFVAYDFFYYWEHR
FT                   ANHRVRILWASHVVHHSSRHYNLSTALRQTWTGVGNTIFLLPLALVGFPSYMIFATAAM
FT                   NLLYQFWIHTERIATMWRPIEFVMNTPSHHRVHHGSNQGYLDKNYGGVFIVFDRLFRSF
FT                   EPEGEPVEYGLTKNIGTFNPLRVAAHEYAAIARDVRGAAGWRARFGYVLRGPGWSPASP
FT                   VPATAVTV"
     MRLVIDGIDL TTLAIPFYVL FMALELLSLR FFPDPVEQGY TVKDTATSLT MGIGSIVCNL        60
     GWGLVTVAAV AGVHALAPWH IASSLTGWLV LFVAYDFFYY WEHRANHRVR ILWASHVVHH       120
     SSRHYNLSTA LRQTWTGVGN TIFLLPLALV GFPSYMIFAT AAMNLLYQFW IHTERIATMW       180
     RPIEFVMNTP SHHRVHHGSN QGYLDKNYGG VFIVFDRLFR SFEPEGEPVE YGLTKNIGTF       240
     NPLRVAAHEY AAIARDVRGA AGWRARFGYV LRGPGWSPAS PVPATAVTV                   289
//

If you have problems or comments...

PBIL Back to PBIL home page