(data stored in ACNUC7421 zone)

EMBL: CP001700.PE32

CP001700.PE32        Location/Qualifiers
FT   CDS             31496..32140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0032"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: rpc:RPC_2940 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68987"
FT                   /db_xref="GOA:C7QFP8"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP8"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACU68987.1"
FT                   /translation="MTTDPKAIIESGYDAVAEEYLSTFGEGVPDDPRVRFIGALGEHLA
FT                   DGARVLELGCGAGIPATALLAQRFDVLGVDISAGQLALAAQRVPTAEFRKADMTSLDLP
FT                   AGSFDAVTAFYSFNHIPRAEQQPLLTAIARWLRPGGLLLASFGRGGSADDVELWLGGVP
FT                   MFFASHDPATNTRHLADAGFTPLVDELVSMETGRGSETWQWVLARSGERRR"
     MTTDPKAIIE SGYDAVAEEY LSTFGEGVPD DPRVRFIGAL GEHLADGARV LELGCGAGIP        60
     ATALLAQRFD VLGVDISAGQ LALAAQRVPT AEFRKADMTS LDLPAGSFDA VTAFYSFNHI       120
     PRAEQQPLLT AIARWLRPGG LLLASFGRGG SADDVELWLG GVPMFFASHD PATNTRHLAD       180
     AGFTPLVDEL VSMETGRGSE TWQWVLARSG ERRR                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page