(data stored in ACNUC7421 zone)

EMBL: CP001700.PE320

CP001700.PE320       Location/Qualifiers
FT   CDS             complement(360412..361983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0322"
FT                   /product="TROVE domain protein"
FT                   /note="PFAM: TROVE domain protein; KEGG: nfa:nfa39620
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69275"
FT                   /db_xref="GOA:C7PVB9"
FT                   /db_xref="InterPro:IPR008858"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR037214"
FT                   /db_xref="InterPro:IPR040322"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVB9"
FT                   /inference="protein motif:PFAM:PF05731"
FT                   /protein_id="ACU69275.1"
FT                   /translation="MAKFNKTATKTAKTFEGGKAYKRDPKADLFLLAVTNMVGEDTFYE
FT                   SADTRDERYRDLVHAVAVSDPEWMLRFVTWLRAEANMRSAAVVAACESVRARLDAEASG
FT                   YGRQLIAAACQRADEPGEVLAYWTGRYGRALPKPVKRGVADAVAHLYNEYSFAKYDSDA
FT                   KGFRFGDVIDLVHPAAAADKPWQGELFRHALDRRHNRDNPVPEALPKLAKRAALLGLPV
FT                   AERRGVLLAEGGAQRLAEAGMTWEALAGWLQGPMDQAAWEAVIPSMGLMALARNLRNFD
FT                   EAGVADAVAWRVCSRFLDAGQVGRSRMLPYRWLSAYKAAPSLRWGHALEGALGHAIAGV
FT                   PELPGRTLVLVDTSGSMTGRVSARSTVTHLDIGALIGVALADRAAGSGRADDVDLVGFA
FT                   DGVFRHELTKGGSVLRGIEAFAKRSGEVGHGTRMIDAIAATYDRHDRVVIVSDMQAFPY
FT                   FYHQNKGADAFIPDTVPVFGINTAGYGPSALPPGKRNRFEIGGFSDKVFTLFGLLASGD
FT                   DPALPF"
     MAKFNKTATK TAKTFEGGKA YKRDPKADLF LLAVTNMVGE DTFYESADTR DERYRDLVHA        60
     VAVSDPEWML RFVTWLRAEA NMRSAAVVAA CESVRARLDA EASGYGRQLI AAACQRADEP       120
     GEVLAYWTGR YGRALPKPVK RGVADAVAHL YNEYSFAKYD SDAKGFRFGD VIDLVHPAAA       180
     ADKPWQGELF RHALDRRHNR DNPVPEALPK LAKRAALLGL PVAERRGVLL AEGGAQRLAE       240
     AGMTWEALAG WLQGPMDQAA WEAVIPSMGL MALARNLRNF DEAGVADAVA WRVCSRFLDA       300
     GQVGRSRMLP YRWLSAYKAA PSLRWGHALE GALGHAIAGV PELPGRTLVL VDTSGSMTGR       360
     VSARSTVTHL DIGALIGVAL ADRAAGSGRA DDVDLVGFAD GVFRHELTKG GSVLRGIEAF       420
     AKRSGEVGHG TRMIDAIAAT YDRHDRVVIV SDMQAFPYFY HQNKGADAFI PDTVPVFGIN       480
     TAGYGPSALP PGKRNRFEIG GFSDKVFTLF GLLASGDDPA LPF                         523
//

If you have problems or comments...

PBIL Back to PBIL home page