(data stored in ACNUC7421 zone)

EMBL: CP001700.PE321

CP001700.PE321       Location/Qualifiers
FT   CDS             complement(362213..363790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0323"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sgr:SGR_5254 major facilitator superfamily permease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69276"
FT                   /db_xref="GOA:C7PVC0"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC0"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACU69276.1"
FT                   /translation="MSTNSPPSGRRQRLILTVLIFAQLLIWIDGTVLSTAYETLADPVR
FT                   GLGATPGQLQWATGSYTLVLATVTFTGGALGDRFGHRNTLLAGMALFGLASVFAAYSQN
FT                   TGQLIAARAVMGLGAALLIPATLAVISFTYPPEQRPQAFGVLSSFAGVGIAAGPVLAGL
FT                   MLANFWWGSVFLINVPVVVLGLVAIARTVPNFQPPAKRGLDFPGLLLSSAGLGLLSYGL
FT                   IRAGQDGTVTEPQVWITVAGGLVVTAAFVVVELRRRHPSFDPRLFRLRQFAAGNVSLTL
FT                   LFLALSASGFYFAFYLQGARGYSALRASLVGIPGALGVVIGGPVAAKLARRTSVRRVSG
FT                   TALTVSTITLLVFSRVGLGLPIPAYIAVSIVQATAIGMTIAPLTGAILGSLPLAQAGAG
FT                   SAVNATMRQTGSVLGIALGGTILSIGYRHAIGGSVAALPAPLKQQAETSAEMARNVARH
FT                   NGIPNLAHQADLAFVHAMHTGMVWSAAATGIGALLVFGAFANPRKTKTEAVTAQLEAST
FT                   VVPESASA"
     MSTNSPPSGR RQRLILTVLI FAQLLIWIDG TVLSTAYETL ADPVRGLGAT PGQLQWATGS        60
     YTLVLATVTF TGGALGDRFG HRNTLLAGMA LFGLASVFAA YSQNTGQLIA ARAVMGLGAA       120
     LLIPATLAVI SFTYPPEQRP QAFGVLSSFA GVGIAAGPVL AGLMLANFWW GSVFLINVPV       180
     VVLGLVAIAR TVPNFQPPAK RGLDFPGLLL SSAGLGLLSY GLIRAGQDGT VTEPQVWITV       240
     AGGLVVTAAF VVVELRRRHP SFDPRLFRLR QFAAGNVSLT LLFLALSASG FYFAFYLQGA       300
     RGYSALRASL VGIPGALGVV IGGPVAAKLA RRTSVRRVSG TALTVSTITL LVFSRVGLGL       360
     PIPAYIAVSI VQATAIGMTI APLTGAILGS LPLAQAGAGS AVNATMRQTG SVLGIALGGT       420
     ILSIGYRHAI GGSVAALPAP LKQQAETSAE MARNVARHNG IPNLAHQADL AFVHAMHTGM       480
     VWSAAATGIG ALLVFGAFAN PRKTKTEAVT AQLEASTVVP ESASA                       525
//

If you have problems or comments...

PBIL Back to PBIL home page