(data stored in ACNUC7421 zone)

EMBL: CP001700.PE323

CP001700.PE323       Location/Qualifiers
FT   CDS             364672..365445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro03810 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69278"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC2"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro03810"
FT                   /protein_id="ACU69278.1"
FT                   /translation="MSTSLLFTSDSSADGVRERDFTVGGVPGVLWSPDSRPDRAPLVLI
FT                   GHGGGIHKKAPGSAGRARALVLGCGFHVAAIDAPGHGDRPRTEHDEREIDALFAARDAG
FT                   EPEGPIVVRYNAYLAEQAVPEWRATLDALQELREIGADGPVGYWGINMGTAIGIPFVAA
FT                   DPRITAAVFGQHWPDFLAEPAKRITIPVEFDLQWDDEHIPRSAGLALFDAFASPEKTLH
FT                   ANAGRHKQLPRFEADSAVRFFARHFGAPAAGTAAA"
     MSTSLLFTSD SSADGVRERD FTVGGVPGVL WSPDSRPDRA PLVLIGHGGG IHKKAPGSAG        60
     RARALVLGCG FHVAAIDAPG HGDRPRTEHD EREIDALFAA RDAGEPEGPI VVRYNAYLAE       120
     QAVPEWRATL DALQELREIG ADGPVGYWGI NMGTAIGIPF VAADPRITAA VFGQHWPDFL       180
     AEPAKRITIP VEFDLQWDDE HIPRSAGLAL FDAFASPEKT LHANAGRHKQ LPRFEADSAV       240
     RFFARHFGAP AAGTAAA                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page