(data stored in ACNUC7421 zone)

EMBL: CP001700.PE324

CP001700.PE324       Location/Qualifiers
FT   CDS             complement(365498..366184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0326"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_2940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69279"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69279.1"
FT                   /translation="MAEPHAAWGMRQIEEFNEFLPIGPWTVNLDERRYRQSGRELRISV
FT                   LGSFDTAEGSWLWGWANPGFGKLPVVAAAEALRSFGLDHGVPEFSEELVDLSGFEDPRY
FT                   AAEMLAFGAMGVLRADGYIGVQANETGRLYMVPDDPQVPVADPDPIALPRLLMQGAQFF
FT                   NRSAYEVVAGYFHHFTIPWRQEGDTITAELPGGATASVQFDGQGRVAAVSMGSITKESL
FT                   GNTADA"
     MAEPHAAWGM RQIEEFNEFL PIGPWTVNLD ERRYRQSGRE LRISVLGSFD TAEGSWLWGW        60
     ANPGFGKLPV VAAAEALRSF GLDHGVPEFS EELVDLSGFE DPRYAAEMLA FGAMGVLRAD       120
     GYIGVQANET GRLYMVPDDP QVPVADPDPI ALPRLLMQGA QFFNRSAYEV VAGYFHHFTI       180
     PWRQEGDTIT AELPGGATAS VQFDGQGRVA AVSMGSITKE SLGNTADA                    228
//

If you have problems or comments...

PBIL Back to PBIL home page