(data stored in ACNUC7421 zone)

EMBL: CP001700.PE325

CP001700.PE325       Location/Qualifiers
FT   CDS             complement(366387..367406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0327"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein;
FT                   regulatory protein MerR; KEGG: fre:Franean1_1870
FT                   helix-turn-helix type 11 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69280"
FT                   /db_xref="GOA:C7PVC4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC4"
FT                   /inference="protein motif:PFAM:PF08279"
FT                   /protein_id="ACU69280.1"
FT                   /translation="MNHPAGRVLTLLELLQSGGVRTAAEIAERLGVDARTVRRYVEQLL
FT                   ELEIPVESVRGRYGGYRLARGFRLPPLMLGDDEALAVLLGLLAGRRSGLTAALGAAGET
FT                   AGAKIRRVLPARLSERLRSVLDSVAFTGAPDQSAALDATVLLTVADAVANQRPIAVRYT
FT                   GRDGVRGDRTLHPYAIVSHGERWYVRALDPAIGEERTFRLDRIDGARALPGSFEAPTMD
FT                   DDPGQSLLAGFAAADYRYEVAIRVHGTVEQIRARFPVSVATIQPLSDANGNGDGNGNGN
FT                   EAQTPWHRLAIRAEHLDWIPPTLAALDLPFEIEDPDELRDLVIAFADRLATRARGGLE"
     MNHPAGRVLT LLELLQSGGV RTAAEIAERL GVDARTVRRY VEQLLELEIP VESVRGRYGG        60
     YRLARGFRLP PLMLGDDEAL AVLLGLLAGR RSGLTAALGA AGETAGAKIR RVLPARLSER       120
     LRSVLDSVAF TGAPDQSAAL DATVLLTVAD AVANQRPIAV RYTGRDGVRG DRTLHPYAIV       180
     SHGERWYVRA LDPAIGEERT FRLDRIDGAR ALPGSFEAPT MDDDPGQSLL AGFAAADYRY       240
     EVAIRVHGTV EQIRARFPVS VATIQPLSDA NGNGDGNGNG NEAQTPWHRL AIRAEHLDWI       300
     PPTLAALDLP FEIEDPDELR DLVIAFADRL ATRARGGLE                              339
//

If you have problems or comments...

PBIL Back to PBIL home page