(data stored in ACNUC7421 zone)

EMBL: CP001700.PE326

CP001700.PE326       Location/Qualifiers
FT   CDS             367470..367901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0328"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: sco:SCO4486 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69281"
FT                   /db_xref="GOA:C7PVC5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC5"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACU69281.1"
FT                   /translation="MTTNLASTRIITADIASLVAFYEKATALPATWATPDFAELATPAG
FT                   ATLAIGSTRTVPLFAPDSAAPGANRSVIIEFLVDDVDALWQRLAAWIPASDVVAEPKTL
FT                   PWGNRSLLVRDPDGTLVNFFTPVTPEARAKYGLSALIES"
     MTTNLASTRI ITADIASLVA FYEKATALPA TWATPDFAEL ATPAGATLAI GSTRTVPLFA        60
     PDSAAPGANR SVIIEFLVDD VDALWQRLAA WIPASDVVAE PKTLPWGNRS LLVRDPDGTL       120
     VNFFTPVTPE ARAKYGLSAL IES                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page