(data stored in ACNUC7421 zone)

EMBL: CP001700.PE327

CP001700.PE327       Location/Qualifiers
FT   CDS             complement(367879..368469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0329"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mab:MAB_1873c
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69282"
FT                   /db_xref="GOA:C7PVC6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC6"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69282.1"
FT                   /translation="MTADPSSPAQQQLRADALRNRESVLAAATAAFAASEAEPSMREIA
FT                   RQAGVGVATLYRHFPTREALVDAVYQDQVVRLTAGARDLLAAHPPARALRLWMDLFADW
FT                   LTTKRGMTGTLLAMVDAGDISLAHTRGELLAAIATILDAGIAAGEIRADTSAEDVSAAV
FT                   LGLLAVSGERGNPEQAQRLLDVLMDGLRTRSER"
     MTADPSSPAQ QQLRADALRN RESVLAAATA AFAASEAEPS MREIARQAGV GVATLYRHFP        60
     TREALVDAVY QDQVVRLTAG ARDLLAAHPP ARALRLWMDL FADWLTTKRG MTGTLLAMVD       120
     AGDISLAHTR GELLAAIATI LDAGIAAGEI RADTSAEDVS AAVLGLLAVS GERGNPEQAQ       180
     RLLDVLMDGL RTRSER                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page