(data stored in ACNUC7421 zone)

EMBL: CP001700.PE328

CP001700.PE328       Location/Qualifiers
FT   CDS             368589..369569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0330"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   KEGG: fal:FRAAL3688 putative zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69283"
FT                   /db_xref="GOA:C7PVC7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC7"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACU69283.1"
FT                   /translation="MADRITPPDTMRTVRFREYGEPADVLRLEIASVPAPSPGRIRIAV
FT                   HACGLAPADWALCRGLFAGDLPRGIGCDVAGTVEAVGEGVTDVAIGDPVFGTADYAGQP
FT                   SAGAADHAIMDHWYTVPEGLDLIQAAALPMALSTAYWHLTRLGLSAGSTLLVNGAGTTI
FT                   GYAAVQIALHRGLHVIATAGETYAPQLKNLGATVTAYGDGLPDRVAALSDTPIDIVFDT
FT                   APPNGALPDLIRIADDDPQRILTCSDLATAPDLGARDTFHEDRTTFTDADRFSHFPEFA
FT                   HLAAKGKFTVPVAGTFPLDQWRTALDISQSGHARGKLLLLPGSQR"
     MADRITPPDT MRTVRFREYG EPADVLRLEI ASVPAPSPGR IRIAVHACGL APADWALCRG        60
     LFAGDLPRGI GCDVAGTVEA VGEGVTDVAI GDPVFGTADY AGQPSAGAAD HAIMDHWYTV       120
     PEGLDLIQAA ALPMALSTAY WHLTRLGLSA GSTLLVNGAG TTIGYAAVQI ALHRGLHVIA       180
     TAGETYAPQL KNLGATVTAY GDGLPDRVAA LSDTPIDIVF DTAPPNGALP DLIRIADDDP       240
     QRILTCSDLA TAPDLGARDT FHEDRTTFTD ADRFSHFPEF AHLAAKGKFT VPVAGTFPLD       300
     QWRTALDISQ SGHARGKLLL LPGSQR                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page