(data stored in ACNUC7421 zone)

EMBL: CP001700.PE329

CP001700.PE329       Location/Qualifiers
FT   CDS             369649..370095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0331"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rha:RHA1_ro06883
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69284"
FT                   /db_xref="GOA:C7PVC8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC8"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACU69284.1"
FT                   /translation="MDDVEVVDRISGRVILLDPNGRALLFQGFDPQRPNQLWWITPGGG
FT                   LEPGETPQQAAARELQEETSLDVQPQDLGEAVFRNYVEFFFDGRLLRQHNHFFTLRTEP
FT                   FEISTAGFDALEQRTHLTHRWWTLEELRTTDETFFPEELPDLLS"
     MDDVEVVDRI SGRVILLDPN GRALLFQGFD PQRPNQLWWI TPGGGLEPGE TPQQAAAREL        60
     QEETSLDVQP QDLGEAVFRN YVEFFFDGRL LRQHNHFFTL RTEPFEISTA GFDALEQRTH       120
     LTHRWWTLEE LRTTDETFFP EELPDLLS                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page