(data stored in ACNUC7421 zone)

EMBL: CP001700.PE33

CP001700.PE33        Location/Qualifiers
FT   CDS             33113..34141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0033"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: sco:SCO3843 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68988"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP9"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACU68988.1"
FT                   /translation="MGVLQRFERRIEGLVNGAFAKAFKSEVQPVEIASALQRECDDRAA
FT                   IVSQGRTMVPNDFTVELGGVDYERLATYAGPLGAELAELVREYGAEQRYMFVGPVEVKF
FT                   ARAADLDTGMFRIQSQALAGVVPVSSMQGEPQGYDPYGQPPPYQGGPQGGPQGPGGPQG
FT                   PGGPQGPGGLQPVPPPNPVPQPAPWGSPPPPQGQGGPQPGWGAPPPGQGGYDQGGYDPY
FT                   GQPPPQQPGWGPPGQQQQQQQYAPPPQSQTQCWVEINGARHMLTKPVTTMGRGTDVDLR
FT                   VDDPSVSRRHAEIRIGTPSYVSDLGSTNGIVVDNQHVTQAPLRDGSVIHLGTTTIIFRQ
FT                   QG"
     MGVLQRFERR IEGLVNGAFA KAFKSEVQPV EIASALQREC DDRAAIVSQG RTMVPNDFTV        60
     ELGGVDYERL ATYAGPLGAE LAELVREYGA EQRYMFVGPV EVKFARAADL DTGMFRIQSQ       120
     ALAGVVPVSS MQGEPQGYDP YGQPPPYQGG PQGGPQGPGG PQGPGGPQGP GGLQPVPPPN       180
     PVPQPAPWGS PPPPQGQGGP QPGWGAPPPG QGGYDQGGYD PYGQPPPQQP GWGPPGQQQQ       240
     QQQYAPPPQS QTQCWVEING ARHMLTKPVT TMGRGTDVDL RVDDPSVSRR HAEIRIGTPS       300
     YVSDLGSTNG IVVDNQHVTQ APLRDGSVIH LGTTTIIFRQ QG                          342
//

If you have problems or comments...

PBIL Back to PBIL home page