(data stored in ACNUC7421 zone)

EMBL: CP001700.PE330

CP001700.PE330       Location/Qualifiers
FT   CDS             complement(370550..371932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0332"
FT                   /product="replicative DNA helicase"
FT                   /note="KEGG: sgr:SGR_3669 putative replicative DNA
FT                   helicase; TIGRFAM: replicative DNA helicase; PFAM: DnaB
FT                   domain protein helicase domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69285"
FT                   /db_xref="GOA:C7PVC9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVC9"
FT                   /inference="protein motif:TFAM:TIGR00665"
FT                   /protein_id="ACU69285.1"
FT                   /translation="MSIDDLPYTADEAYQGGFERTPPQDIPAEQSVLGGMLLSKDAIAE
FT                   VIEVIKAIDFYKPAHEAVFGAILELYGRGEPADPVTVAALLTKKGDINRIGGAPYLHTL
FT                   INSVPTAANAGYYAEIVKERAVLRRLVEAGTRIVQMGYSTDGSDVEQIVDAAQQEMYNV
FT                   TEARTSEDFIPLADAMEGALDEIESISNRSGQMTGVPTGFHDLDALTNGLHPGQMVIIA
FT                   ARPAIGKSTLGLDLARSCSIKNGLTSVIFSLEMGRNEIIMRLLSAEARVALHHMRSGTM
FT                   TDEDWARLARRMGPVSEAPLFIDDSPNMSMMEIRAKARRLKQRHDLQLVIIDYMQLMQH
FT                   SSSNSKRPDSRQQEVSEISRSLKLLAKELEVPVIAISQLNRGPEQRTDKRPMMSDLRES
FT                   GSLEQDADVIILLHREDAYERESPRAGEADLIVAKHRNGPTANITVAFQGHYSRFVDMA
FT                   QS"
     MSIDDLPYTA DEAYQGGFER TPPQDIPAEQ SVLGGMLLSK DAIAEVIEVI KAIDFYKPAH        60
     EAVFGAILEL YGRGEPADPV TVAALLTKKG DINRIGGAPY LHTLINSVPT AANAGYYAEI       120
     VKERAVLRRL VEAGTRIVQM GYSTDGSDVE QIVDAAQQEM YNVTEARTSE DFIPLADAME       180
     GALDEIESIS NRSGQMTGVP TGFHDLDALT NGLHPGQMVI IAARPAIGKS TLGLDLARSC       240
     SIKNGLTSVI FSLEMGRNEI IMRLLSAEAR VALHHMRSGT MTDEDWARLA RRMGPVSEAP       300
     LFIDDSPNMS MMEIRAKARR LKQRHDLQLV IIDYMQLMQH SSSNSKRPDS RQQEVSEISR       360
     SLKLLAKELE VPVIAISQLN RGPEQRTDKR PMMSDLRESG SLEQDADVII LLHREDAYER       420
     ESPRAGEADL IVAKHRNGPT ANITVAFQGH YSRFVDMAQS                             460
//

If you have problems or comments...

PBIL Back to PBIL home page